PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00013713001
Common NameGSBRNA2T00013713001, LOC106382530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 300aa    MW: 34280.9 Da    PI: 7.7895
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00013713001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.71.9e-31144197255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+v++Ltl+hvkSHLQ+YR+
  GSBRNA2T00013713001 144 PRMRWTTTLHAHFVRAVQLLGGHERATPKSVLELMDVQDLTLAHVKSHLQMYRT 197
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.48E-15141198IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-27142198IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-23144198IPR006447Myb domain, plants
PfamPF002497.3E-7145196IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MELFPSQPDL NLNISRRREE QDDKEQEQVE RRLVYQSQAS DSVRNASGHL IDTVKFTSNY  60
EPTKFYHYQE HNESQDQDSR SILMVSQNQT LGHYYYSPTP PFFFSEVNGQ HANPNYSYKL  120
HHGHRRQAQP QPQRCTAKRG VRAPRMRWTT TLHAHFVRAV QLLGGHERAT PKSVLELMDV  180
QDLTLAHVKS HLQMYRTIKS TEKPTTSPGQ SDTCENGSQV KSERQARDLQ GLWNNSSSEA  240
RLHLKANASG LDVSSNKKVD QRCESYELLS SDSSSLTWTR PETETPNLDF TLATPNLPP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3534550.0AK353455.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-31-C13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013600916.10.0PREDICTED: probable transcription factor KAN3 isoform X1
RefseqXP_013678013.10.0PREDICTED: probable transcription factor KAN3 isoform X1
SwissprotQ941I21e-142KAN3_ARATH; Probable transcription factor KAN3
TrEMBLA0A078ISY30.0A0A078ISY3_BRANA; BnaCnng26550D protein
TrEMBLA0A0D3DMJ20.0A0A0D3DMJ2_BRAOL; Uncharacterized protein
STRINGBra040176.1-P1e-151(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139841825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17695.11e-136G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]